Short menu

Bioinformatics research in biotechnology

Bioinformatics server for bioinformatics analysisis an open source,
web-based platform for data intensive biomedical research

Integration into existing workflows is another common obstacle to effective AI implementation

Machine learning for RNA 2D structure prediction

Bioinformatics Analysis Platform: Get 3D dimer physical properties: Input files-Download Data

Protein Thermostability Calculations

Strategies for Improving Peptide Stability . The possible solutions to enhance the stability of peptides.

Protein Phosphorylation: Mechanisms, Types/There are so many places in the lab where AI can streamline and improve processes and boost performance. Data mining is a perfect example – it involves using AI to analyze and process huge datasets of information, distilling it down into digestible, actionable insights.

A deep learning method for predicting antibody-antigen interactions based on sequence information

Predicting the Effects of Single Mutations on Protein Stability

Bioinformatics Analysis Platform: machine learning

Examples

Preliminary results using a bioinformatics server to obtain thermodynamic parameters of the interaction of proteins with small chemical molecules

Step-by-step use of the server for calculating various biological complexes:
monomer, dimer, tetramer, monomer+inhibitor, tetramer+2 inhibitors, etc.
Subsequent analysis of the obtained thermodynamic parameters will allow to build biochemical processes occurring in normal and malignant cells
The Different Lab AI Tools
There are so many AI tools out there that it can be hard to know where to begin. Plenty have been purpose-built for a lab environment and serve a unique purpose. Most of these tools involve Machine learning (ML) algorithms that improve through experience, making them ideal for analyzing large, complex datasets and identifying patterns that may not be immediately obvious to researchers.
Results: The calculation of the physical quantities of interaction characterizing the formation of each complex reveals the direction of the passage of biochemical reactions depending on the affinity and concentration of active elements, thus the platform will help determine stable and transient biological formations with the participation of the studied drugs.

Cloud, check out this in-depth deep learning video created
Link: http://biomarker.co.il/scheme2
BioNTech SE, Novo Nordisk
Get a set of calculated physical quantities for each biological complex in the biochemical cascade and build a diagram and order of interaction of biological molecules in the cell (and beyond) for biotech companies
Regeneron Pharmaceuticals, Vertex Pharmaceuticals
Link: http://biomarker.co.il/scheme3
Natural language processing (NLP): allows humans to communicate with machines in human language. It also allows machines to understand and respond to human commands, facilitating more effective communication.

2D sequence calculations.

PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
experimental research, proteomics, metabolomics, and transcriptomics
PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
experimental research, Computational biology is a fast and increasingly growing field
First seq.
Second seq.
Algorithm N1
Algorithm N2

Bioinformatics Resource Portal

Calculate and predict biochemical experiments online - save time and money

Online server for calculating 3D structures to determine the stability of such structures when introducing missense mutations

Leave your request and our specialists will contact you shortly

on all issues

Meet the group, explore the school, and get a free consultation
Hello! I have a question about the study of molecules
list of molecules:
I would like to study the following properties of these molecules
List of properties:
Made on
Tilda