Follow Binomial lab on F6S

Bioinformatics research in biotechnology

Bioinformatics server for bioinformatics analysisis an open source,
web-based platform for data intensive biomedical research
antibody antigen, bioinformatics, flexible chains
p53, bioinformatics, flexible chains
New! AI and Machine learning
for computational biochemistry:
Protein
Monomer
Dimer
Monomer+Inhibitor+atom
soft and lectures
peptide stability (Aggregation kinetics)
Antibody-Antigen
Target protein+Fab2
RNA molecules
2D and 3D molecules
Stability,
entropy change,
enthalpy,
dissociation energy,
Gibbs free energy.
graphs, curves, dependencies
protein phosphorylation
peptide stability

web tools for the prediction of various structural features of proteins based on the protein sequence

Machine learning for RNA 2D structure prediction

Bioinformatics Analysis Platform: Get 3D dimer physical properties: Input files-Download Data

Protein Thermostability Calculations

Strategies for Improving Peptide Stability . The possible solutions to enhance the stability of peptides.

Protein Phosphorylation: Mechanisms, Types

A deep learning method for predicting antibody-antigen interactions based on sequence information

Predicting the Effects of Single Mutations on Protein Stability

Bioinformatics Analysis Platform: machine learning

Examples

Preliminary results using a bioinformatics server to obtain thermodynamic parameters of the interaction of proteins with small chemical molecules

Step-by-step use of the server for calculating various biological complexes:
monomer, dimer, tetramer, monomer+inhibitor, tetramer+2 inhibitors, etc.
Subsequent analysis of the obtained thermodynamic parameters will allow to build biochemical processes occurring in normal and malignant cells
Results: The calculation of the physical quantities of interaction characterizing the formation of each complex reveals the direction of the passage of biochemical reactions depending on the affinity and concentration of active elements, thus the platform will help determine stable and transient biological formations with the participation of the studied drugs.

Cloud, check out this in-depth deep learning video created
Link: http://biomarker.co.il/scheme2
BioNTech SE, Novo Nordisk
Get a set of calculated physical quantities for each biological complex in the biochemical cascade and build a diagram and order of interaction of biological molecules in the cell (and beyond) for biotech companies
Regeneron Pharmaceuticals, Vertex Pharmaceuticals
Link: http://biomarker.co.il/scheme3
We will be very grateful for any possible assistance to the developers!
Tilda Publishing

2D sequence calculations.

Novavax, analyzing large amounts of data
Best Computational Biology , Vertex Pharmaceuticals
PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
experimental research, proteomics, metabolomics, and transcriptomics
PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
experimental research, Computational biology is a fast and increasingly growing field
First seq.
Second seq.
Algorithm N1
Algorithm N2

Bioinformatics Resource Portal

Calculate and predict biochemical experiments online - save time and money

Calculate Molecule Properties

Online server for calculating 3D structures to determine the stability of such structures when introducing missense mutations

Chat Online without Registration

Here you can ask a question about your personal research specifics; perhaps you have not found the section that is suitable for you, ask a question or attach a file.
Electronic box for feedback: server@binomlabs.com
Responsible editor-in-chief in the field of mathematical physics
and machine learning:
Made on
Tilda