Bioinformatics research in biotechnology
Bioinformatics server for bioinformatics analysisis an open source,
web-based platform for data intensive biomedical research
web-based platform for data intensive biomedical research
Integration into existing workflows is another common obstacle to effective AI implementation
Machine learning for RNA 2D structure prediction
Bioinformatics Analysis Platform: Get 3D dimer physical properties: Input files-Download Data
Protein Thermostability Calculations
Strategies for Improving Peptide Stability . The possible solutions to enhance the stability of peptides.
Protein Phosphorylation: Mechanisms, Types/There are so many places in the lab where AI can streamline and improve processes and boost performance. Data mining is a perfect example – it involves using AI to analyze and process huge datasets of information, distilling it down into digestible, actionable insights.
A deep learning method for predicting antibody-antigen interactions based on sequence information
Predicting the Effects of Single Mutations on Protein Stability
Bioinformatics Analysis Platform: machine learning
Examples
Preliminary results using a bioinformatics server to obtain thermodynamic parameters of the interaction of proteins with small chemical molecules
Step-by-step use of the server for calculating various biological complexes:
monomer, dimer, tetramer, monomer+inhibitor, tetramer+2 inhibitors, etc.
Subsequent analysis of the obtained thermodynamic parameters will allow to build biochemical processes occurring in normal and malignant cells
monomer, dimer, tetramer, monomer+inhibitor, tetramer+2 inhibitors, etc.
Subsequent analysis of the obtained thermodynamic parameters will allow to build biochemical processes occurring in normal and malignant cells
The Different Lab AI Tools
There are so many AI tools out there that it can be hard to know where to begin. Plenty have been purpose-built for a lab environment and serve a unique purpose. Most of these tools involve Machine learning (ML) algorithms that improve through experience, making them ideal for analyzing large, complex datasets and identifying patterns that may not be immediately obvious to researchers.
There are so many AI tools out there that it can be hard to know where to begin. Plenty have been purpose-built for a lab environment and serve a unique purpose. Most of these tools involve Machine learning (ML) algorithms that improve through experience, making them ideal for analyzing large, complex datasets and identifying patterns that may not be immediately obvious to researchers.
Results: The calculation of the physical quantities of interaction characterizing the formation of each complex reveals the direction of the passage of biochemical reactions depending on the affinity and concentration of active elements, thus the platform will help determine stable and transient biological formations with the participation of the studied drugs.
Link: http://biomarker.co.il/scheme2
Get a set of calculated physical quantities for each biological complex in the biochemical cascade and build a diagram and order of interaction of biological molecules in the cell (and beyond) for biotech companies
Link: http://biomarker.co.il/scheme3
Natural language processing (NLP): allows humans to communicate with machines in human language. It also allows machines to understand and respond to human commands, facilitating more effective communication.
2D sequence calculations.
PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
First seq.
Second seq.
Algorithm N1
Algorithm N2
Bioinformatics Resource Portal
Calculate and predict biochemical experiments online - save time and money
Calculate Molecule Properties
Online server for calculating 3D structures to determine the stability of such structures when introducing missense mutations
| |
Leave your request and our specialists will contact you shortly on all issues Meet the group, explore the school, and get a free consultation |
Responsible editor-in-chief in the field of mathematical physics
and machine learning:
and machine learning:
